PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g07050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 785aa    MW: 88410.6 Da    PI: 6.2821
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g07050.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.11.2e-25179232155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++Wt++LH +Fv+av+qL G e+A+P +i +lm+ + Lt++hv+SHLQkYR 
  Vang05g07050.1 179 KPRVVWTTDLHGKFVKAVNQL-GLENAVPNKIQQLMNTPHLTRNHVASHLQKYRN 232
                     79*******************.********************************5 PP

2G2-like445.1e-14505558152
         G2-like   1 kprlrWtpeLHerFveaveqLGGse...kAtPktilelmkvkgLtlehvkSHLQk 52 
                     kpr++W ++L ++Fv+av  +G +e    AtPk++le+m+ + L ++h++SHLQk
  Vang05g07050.1 505 KPRVVWDQKLNASFVSAVLIIG-IEsmiDATPKKVLEVMNDPRLERTHIASHLQK 558
                     79*******************6.442336*************************8 PP

3Response_reg54.75.7e-19201281110
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                     vl +d +p+v+e +++++++  ye+++ +++ ++a+ l ++k  +Dlil+ + mp+mdG+e+l  ++++e ++p ++++  ++++ + + +k+Ga
  Vang05g07050.1  20 VLAIDTDPIVLEFIKKVCNEYCYEVITCTESLSAAIILQEKKStIDLILMEVHMPHMDGYEFL--LTTQEINVPKLMMSFDDSKKSVMKTIKLGA 112
                     7899*******************888888888888766644446******************8..5666677*******9999************ PP

                     SEEEESS--HHHHHHH CS
    Response_reg  95 kdflsKpfdpeelvka 110
                      d+  Kp ++++l+++
  Vang05g07050.1 113 CDYMIKPLHEDRLRNM 128
                     ************9975 PP

4Response_reg62.71.8e-213314323103
                     EESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
    Response_reg   3 ivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                      +d + +v+e +++ ++++g+ +v +++++++a++ l++++  +Dlil+ ++mp m+G+e+l+ i++e+ ++p i++++ ++ + + +a++ Ga 
  Vang05g07050.1 331 AIDTNLTVLEFIKNTCNHDGI-QVLACSESQSAVNALRKRKqrIDLILVEVDMPIMNGYEFLEFIKKEQVDVPLIMMSSDNSRASVMRAMEHGAY 424
                     5788999**************.9999***********776667**************************************************** PP

                     EEEESS-- CS
    Response_reg  96 dflsKpfd 103
                     d+ +Kp +
  Vang05g07050.1 425 DYWVKPLQ 432
                     ******75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.12E-2416145IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.1E-2617149No hitNo description
SMARTSM004485.3E-1218129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.54819133IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-1620128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.70E-1721132No hitNo description
Gene3DG3DSA:1.10.10.601.9E-26176235IPR009057Homeodomain-like
SuperFamilySSF466898.24E-17177235IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-22179232IPR006447Myb domain, plants
PfamPF002492.0E-7181231IPR001005SANT/Myb domain
SuperFamilySSF521724.27E-24326444IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.5E-25327451No hitNo description
SMARTSM004488.4E-18327438IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011029.866328444IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-18329433IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.69E-21332443No hitNo description
SuperFamilySSF466891.25E-6503559IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-15503558IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-13505558IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MGKISSEKKV FSEYPSNLKV LAIDTDPIVL EFIKKVCNEY CYEVITCTES LSAAIILQEK  60
KSTIDLILME VHMPHMDGYE FLLTTQEINV PKLMMSFDDS KKSVMKTIKL GACDYMIKPL  120
HEDRLRNMWT HVVRKSMNED KMRKNIRNSL EDDNQNSRFV FSSSDEISRE VGNAGQSKKP  180
RVVWTTDLHG KFVKAVNQLG LENAVPNKIQ QLMNTPHLTR NHVASHLQKY RNVLKEKARR  240
EKERQPEPKR EQQSVPDIQM DNHHAEEAFG FALSDPVAIY PTIAIPQNFP QTLDSECGVW  300
LHCKAMAKFG SPATHIEDTV PQVPSALTIV AIDTNLTVLE FIKNTCNHDG IQVLACSESQ  360
SAVNALRKRK QRIDLILVEV DMPIMNGYEF LEFIKKEQVD VPLIMMSSDN SRASVMRAME  420
HGAYDYWVKP LQEFNFTIMR ARVFQKKCMI ADKLQKDSGC LKDDDKRRGR SDNSELASCM  480
VHRSNSNFEE ADVVDESCNP SPTKKPRVVW DQKLNASFVS AVLIIGIESM IDATPKKVLE  540
VMNDPRLERT HIASHLQKDM SLPRTSALQP CSATATTNFH PGFTGNMEEE ALAHGHPLAA  600
FPNVVIPENF SEEQSNINRL LSNNFNAEQV LAHDHPSAIF PNIASNLISQ PGTLDDASIY  660
GLLTPSDTPL FVNPTILQID TMQQPMNHNQ MYPMNFQPSF TMISGNPAFA SQNYNFGMNM  720
GHGSQSIQDG NSIGEGILDQ YSTIDSIYHP EFQNAGLPSG AVRRFAASDY RSQNPYIDGN  780
LYQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-17178236462ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521451.11e-180PREDICTED: two-component response regulator ARR14-like
TrEMBLA0A0S3SER20.0A0A0S3SER2_PHAAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2069324
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-51response regulator 2